SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009388569.1.42102 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009388569.1.42102
Domain Number 1 Region: 271-376
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-16
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 60-193
Classification Level Classification E-value
Superfamily POZ domain 0.000000000196
Family BTB/POZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009388569.1.42102
Sequence length 584
Comment PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Musa acuminata subsp. malaccensis]; AA=GCF_000313855.2; RF=representative genome; TAX=214687; STAX=4641; NAME=Musa acuminata subsp. malaccensis; strain=Doubled-haploid Pahang (DH-Pahang); AL=Chromosome; RT=Minor
Sequence
MEYSHLTAVTALSDSDNCSSVHFSGEAAGAPDSAAPAAEVEALRRLSDNLGSAFQSPDFE
FLADARIAVGHTGDGRAPPLEVGVHRCVLSARSPFFREVFAKRGKGAAMPVRVELKELVR
EFEVGYDALVAVLGYLYTGRVAPLPRAVCMCVDEVCPHEACRPAVDFMAEVLYASFSFQI
SELVSLFQRHLLDILDKVAADDIPMVLSVAKLCDKSCASLLNKCIEIVVRSDLDVITLEK
TMPPDIVKHIMDSRLNLGLVGPEGSSFPDKHVRRIHGALDCDDVELVRMLLKEGNTTLDD
ACALHYAVAYCDSKITTELLDLALADVNHRNLRGYTVLHIAAMCKEPKIIVSLLTKGARP
SDLTVDGRKALQISKRLTNSMEYLRSTEEGEASPKSRLCIEILEQAERSDPQVGEASVSL
AIAGDDLRGRLLYLENRVALARLLFPMEARVAMDIAQVDGTLEFTLGSAANHSTGNRRTA
MDLNEAPFKIKEEHLARMRALSRTVELGKRFFPRCSEVINKIMDDDITEITGFGHNSSEE
KRRRFLELQDVLSKAFSEDKEEFDRSSLSSSSSSTSVGVIRTRR
Download sequence
Identical sequences M0S8K8
XP_009388569.1.42102 XP_018678134.1.42102 GSMUA_Achr2P16670_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]