SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009411942.1.42102 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009411942.1.42102
Domain Number 1 Region: 228-616
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.92e-95
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 14-123
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-26
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 615-685
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.24e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009411942.1.42102
Sequence length 1105
Comment PREDICTED: uncharacterized protein LOC103993562 isoform X1 [Musa acuminata subsp. malaccensis]; AA=GCF_000313855.2; RF=representative genome; TAX=214687; STAX=4641; NAME=Musa acuminata subsp. malaccensis; strain=Doubled-haploid Pahang (DH-Pahang); AL=Chromosome; RT=Minor
Sequence
MADLLGSANADRDIDKALIALKKGAQLLKYGRKGKPKFCPFRLSNDESTLIWFSGGGERT
LKLASVLRIVPGQRTPVFQRYLRPDRDYLSFSLIYNDGKRSLDLICKDKVEAEVWFSGLK
ALISTGQYGRSKIDGWNNGGLNTDDSRGSASNSISDQSIGSTLDSSESRLTSSSIPKNLS
FEYSVTSDISDATNMHVKGVSSDGFRVSISSVPSTSSHGSAQDDFDAAGDVYVWGEVICD
TSTRISADKNSSPSSARSDILLPKPIESNVVLDVHHVACGVRHAALVTRQGELFTWGEES
GGRLGHGVGMDIIHPRLLESLSTFNVDYVACGEFHTCAVTATGELYTWGDGAHNAGLLGH
GTNVSHWMPKRVSGPLEGLQVSYVSCGVWHTAIVTTAGQLFTFGDGTFGVLGHGNRETVL
YPREVESLAGLKTIAVSCGVWHTAAVVEVMVTQSSASSGKLFTWGDGDKYRLGHGDKVAR
LKPTCVPSLIDYNFHRLACGHSLTIGLTTSGQVFTMGSNVYGQLGNPRSDGKLPCMVEDK
LAGEPVGEVACGSYHIAVLTTRGEVYTWGKGANGRLGHGDFEDRKTPTLVEALKDRPVKQ
ISCGSNFTAAICQHKWISGAEQSQCSACRQAFGFTRKKHNCYNCGLVHCHQCSSRKALRA
ALSPNPGKPYRVCDSCYVKLNSGLEPGGVNNKKNAKPWISTESKDKFDKVDTLPKASLSR
NLELIKSLDIKTAKNGKNTNFMYMTQNPKGSSVSPLKSLAFPGGIDMLQAVSKPVQTTGA
NSANRSRAVSPFSRKSSPPRSTTPTPTTSGLSFTKNISDSLKKTNDLLNQELLKLRSEVD
SLRQRCERQDFELQKAEKKAKEAMTVAAEESTKSKAAKEVIKSLTAQLKEMAERLPHGTY
GTNTTIPMHLPNGVESHAIQHIGSSGEHLFINDAGNIANMAPSRTGYLGQINENSGDNTS
VREIYRPNETSAPPTPKIVNAKMEQNLNPQNAGQGEMWASSTRLKDIDSRTIASPQSHDD
AVSAVRSPSELSNDVEAEWIEQFEPGVYITLVTLRDGTRDLKRVRFSRRRFGEQQAEAWW
SENRERVYEKYNFRVPDRTSSAMLT
Download sequence
Identical sequences M0TNI8
GSMUA_Achr8P07850_001 XP_009411942.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]