SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009416813.1.42102 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009416813.1.42102
Domain Number 1 Region: 125-325
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.05e-38
Family Guanidinoacetate methyltransferase 0.0015
Further Details:      
 
Domain Number 2 Region: 9-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-18
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009416813.1.42102
Sequence length 332
Comment PREDICTED: protein arginine N-methyltransferase 2 [Musa acuminata subsp. malaccensis]; AA=GCF_000313855.2; RF=representative genome; TAX=214687; STAX=4641; NAME=Musa acuminata subsp. malaccensis; strain=Doubled-haploid Pahang (DH-Pahang); AL=Chromosome; RT=Minor
Sequence
MAKSAEEQLCEAAVEGDCAKIGDLLSAGADPTYFDASGMTPLMYAARHGHADSARLLLSA
GAPWNALSPSNISAGDLAMEHAHQEAFDVLLNAGIQAELVLGTIARVAERNGEKEGGGLN
YLEDRVSFSEDKLMDSESKAVMMEWERPLMEAHARAVCGGGGKVLNVGFGMGLVDEAIQR
YGPVEHTIVEAHPEVYERMLRSGWGKKENVKIVFGRWQDVLPQLESYDGVFFDTYGEYYE
DLRQFHQHLPRLLKPGGVYSYFNGLCGDNAFFHVVYCQLVALELGNLGYSTQFIPLPVKD
CLTEEVWEGVKRKYWQLDTYYLPVCQPLSDSE
Download sequence
Identical sequences M0TYW1
GSMUA_Achr9P09520_001 XP_009416813.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]