SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009418586.1.42102 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009418586.1.42102
Domain Number 1 Region: 22-144
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-29
Family Ankyrin repeat 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009418586.1.42102
Sequence length 172
Comment PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Musa acuminata subsp. malaccensis]; AA=GCF_000313855.2; RF=representative genome; TAX=214687; STAX=4641; NAME=Musa acuminata subsp. malaccensis; strain=Doubled-haploid Pahang (DH-Pahang); AL=Chromosome; RT=Minor
Sequence
MSPEQQVKTRNYISSRRLFKHRLRERDDRGWTLLHIGARKGDLKEVKRLLDAGMDVNVTA
LGCKALGVTPLHLAAQGGHINVMDELLERGANIDARTKGACGWTPLHIAAKERNKQAIKF
LIENGAFLPPDINDNRFNPPLHYCPGLEWAYEIKHKQEEWLSSSGTSYSSEN
Download sequence
Identical sequences M0U2S8
GSMUA_Achr9P23190_001 XP_009418586.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]