SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009429447.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009429447.1.37143
Domain Number 1 Region: 181-342
Classification Level Classification E-value
Superfamily RNI-like 3.53e-46
Family 28-residue LRR 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009429447.1.37143
Sequence length 345
Comment PREDICTED: tropomodulin-4 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPT
GPLDREALLQYLEQQALEVKERDDLVPFTGEKKGKPYIQPKREIPAEEQITLEPELEEAL
AHATDAEMCDIAAILDMYTLMSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNP
TNIEEILKRVRSNDKELEEVNLNNIQDIPIPMLSELCEAMKANTYVRSFSLVATRSGDPI
ANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWPGDAVEM
EMATVLEQCPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR
Download sequence
Identical sequences A0A0D9S5U7 A0A2J8VEZ8 A0A2K5JK82 A0A2K5LVF0 A0A2K6DJL8 A0A2K6LFE3 A0A2K6QWA7 A9X195 F6PSC9 G8F2C3 H2PZY2 Q9NZQ9
ENSP00000295314 ENSP00000295314 ENSMMUP00000010374 gi|156415984|ref|NP_037485.2| ENSPANP00000004792 ENSPTRP00000002175 ENSMMUP00000010374 ENSP00000295314 ENSPTRP00000002175 9544.ENSMMUP00000010374 9598.ENSPTRP00000002175 9606.ENSP00000295314 NP_037485.2.87134 NP_037485.2.92137 XP_001104793.1.72884 XP_001171015.1.37143 XP_005541992.1.63531 XP_005541993.1.63531 XP_007975457.1.81039 XP_007975458.1.81039 XP_007975459.1.81039 XP_008968671.1.60992 XP_009429447.1.37143 XP_010385512.1.97406 XP_010385514.1.97406 XP_011507751.1.92137 XP_011767571.1.29376 XP_011767572.1.29376 XP_011793234.1.43180 XP_011924951.1.92194 XP_011924952.1.92194 XP_015007436.1.72884 XP_016856578.1.92137 XP_017733218.1.44346 XP_017733221.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]