SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009454312.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009454312.1.37143
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-40
Family Dual specificity phosphatase-like 0.000000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009454312.1.37143
Sequence length 173
Comment PREDICTED: protein tyrosine phosphatase type IVA 3 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKEPHTHKTRCCVM
Download sequence
Identical sequences A0A2I3REL6
ENSPTRP00000035275 XP_003819536.1.60992 XP_008971103.1.60992 XP_008971104.1.60992 XP_009454312.1.37143 XP_009454313.1.37143 XP_014201571.1.60992 XP_016815436.1.37143 XP_016815437.1.37143 XP_016815438.1.37143 XP_016815439.1.37143 XP_016815440.1.37143 XP_016815442.1.37143 ENSPTRP00000035275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]