SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009483557.1.14425 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009483557.1.14425
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-56
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 180-415
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 784-1041
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-38
Family YWTD domain 0.0000574
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-27
Family YWTD domain 0.0000529
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1172-1210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1094-1132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000194
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1134-1170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1051-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000624
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009483557.1.14425
Sequence length 1459
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X2 [Pelecanus crispus]; AA=GCF_000687375.1; RF=representative genome; TAX=36300; STAX=36300; NAME=Pelecanus crispus; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEQKLYWADAKLNFIHKSNL
DGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIFSPMDI
HAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKT
DKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQ
LPDLMGLKATNVRQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELINDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHIVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSA
PTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRK
AQEDGSQSLTVVTSSVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVV
LKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALAIDS
QLGKLFWADSDLRRIESSDLSGRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMT
GREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVH
LVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDTQF
QCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDCSD
SSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTNDY
VVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSS
SSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCS
TDVCDSDYAPSRRVTATTAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTE
RSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_009483557.1.14425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]