SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009570170.1.62272 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009570170.1.62272
Domain Number 1 Region: 20-280
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-56
Family YWTD domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-55
Family YWTD domain 0.00000515
Further Details:      
 
Domain Number 3 Region: 331-561
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-48
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 934-1193
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-39
Family YWTD domain 0.0000568
Further Details:      
 
Domain Number 5 Region: 1324-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1286-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1245-1285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 587-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 890-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000384
Family EGF-type module 0.031
Further Details:      
 
Domain Number 10 Region: 285-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1202-1255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009570170.1.62272
Sequence length 1604
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Cuculus canorus]; AA=GCF_000709325.1; RF=representative genome; TAX=55661; STAX=55661; NAME=Cuculus canorus; AL=Scaffold; RT=Major
Sequence
MLKMLSISHRCRIGSSVASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYS
QGIVFWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIE
VANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSD
IYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWT
DWQTRSIHACNKRTGEKRREILSALYSPMDIQVFSPDRQPYYHTPCEENNGGCSHLCLLS
PRDPFYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIR
HAIAIDYDPVEGYIYWTDDDVRAIRRAYFDGSGAQTLVTTEINHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTSRKILVSENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSE
RRVLVNTSLGWPNGLALDIEKDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTL
LGDYIYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAENNGGCS
HLCFFTPQEIKCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTG
VKEASALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLY
WADTGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDG
TNSITLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQ
YSDYIYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHC
GHLCLAIPNGFRCGCAAHYALDPNSGNCSSPASFLLFSQKSAISRMVPDDQQSPDIILPM
HGLRNVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMGTPNQSQNPEKQPHDLSI
DIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAP
KIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLED
SNILQPMGLTVLGNHLYWIDRQQQMIERVEKMNGYKRTRIQGRIAHLTGIHAVEELDMEE
FSVHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEI
DCIPMAWRCDGFPECDDQSDEDNCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEAD
CDALCLPNQFRCASGQCILVKQQCDSFPDCIDGSDELMCEKSKPASDESQPHSSAIGPVI
GIILSLFVMGGMYFVCQRVVCQRYTGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGI
SCGKSMISSMSLVGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLY
NAEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSD
PYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_009570170.1.62272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]