SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009634839.1.23211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009634839.1.23211
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 180-415
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-40
Family YWTD domain 0.0000429
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-28
Family YWTD domain 0.0000529
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1160-1198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000194
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 1122-1158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1087-1121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 1053-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000241
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009634839.1.23211
Sequence length 1447
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Egretta garzetta]; AA=GCF_000687185.1; RF=representative genome; TAX=188379; STAX=188379; NAME=Egretta garzetta; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSSRSVIVNTDIYWPNGLTLDYEEQKLYWADAKLNFIHKSNL
DGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIFSPMDI
HAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLDNGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKT
DKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQ
LPDLMGLKATNVRQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELINDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSA
PTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRHNIIRK
AQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVV
LKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALAIDS
QLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCP
VHLVLLQDELSCGGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDTQFQCESGQCIDSAL
RCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEE
PAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGY
VPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPIL
NPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSR
RVTAATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPP
SPCTDSS
Download sequence
Identical sequences XP_009634839.1.23211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]