SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009666611.1.43253 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009666611.1.43253
Domain Number 1 Region: 480-735
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-55
Family YWTD domain 0.00000523
Further Details:      
 
Domain Number 2 Region: 179-409
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 782-1041
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-39
Family YWTD domain 0.0000568
Further Details:      
 
Domain Number 4 Region: 1-128
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-24
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1172-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1134-1170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 435-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1093-1133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 738-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000367
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 133-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1051-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009666611.1.43253
Sequence length 1452
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X3 [Struthio camelus australis]; AA=GCF_000698965.1; RF=representative genome; TAX=441894; STAX=8801; NAME=Struthio camelus australis; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGRERXXXXIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANLD
GSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDIQ
VLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEVLL
LARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGS
GAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIV
LNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDLEEDKLYWGDAKTD
KIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIRASRDIIIDQL
PDLMGLKATSVTKVFGTNPCAENNGGCSHLCFFTPQETRCACPIGLELLSDMKTCIIPEA
FLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFMN
GSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWKDLDNPRS
LALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLDT
SMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTNGKNRTLIQGH
LDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSPT
SFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRAK
DDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVLR
GDHDKPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVLFTTGLIRPVALVIDNKL
GKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKT
NGYKRTRIQGRIAHLTGIHAVEELDMEEFSAHPCSRDNGGCSHICIAKGDGTPRCSCPEH
LVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQF
QCEKGQCIDAHLRCNGEIDCQDKSDEADCDTICLPNQFRCASGQCILLKQQCDSFPDCID
GSDELMCEKSKPASDEPQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFP
HEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGASS
SSSSSTKATFYPQILNPPPSPATDRSLYNTEMFYSSNIPSTTRSYRPYLIRGIAPPTTPC
STDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHL
YPPPPSPCTDSS
Download sequence
Identical sequences XP_009666611.1.43253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]