SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009673376.1.43253 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009673376.1.43253
Domain Number 1 Region: 27-126
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-17
Family V set domains (antibody variable domain-like) 0.0081
Further Details:      
 
Domain Number 2 Region: 217-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000379
Family V set domains (antibody variable domain-like) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009673376.1.43253
Sequence length 353
Comment PREDICTED: HERV-H LTR-associating protein 2 isoform X1 [Struthio camelus australis]; AA=GCF_000698965.1; RF=representative genome; TAX=441894; STAX=8801; NAME=Struthio camelus australis; AL=Scaffold; RT=Major
Sequence
MKEHKIPSLLIYFFYIWATVWGYGEQKTVIGQCSRDCILPCLFPPGDNVLIHWSKNGKNV
HCYNQEKQEEKQDEDYKNRTQLFHQYISSGNASLKLSNLTLTDAGTYHCYVGTDQTKTEE
DIMLHVRVSSYYALEYQKTDTERMLKCYAFLTYSVPTITWTQSNTSIQETGGEKTEAGGL
YAIRSDQNIANTSAPYQCRILFCRKEWTAESKMEEQLSSVEGNSAAIPCECINNPSSHTE
GFSVVWTINRNAVISVLASFNGTSHSYQPRAQINETDFSLMLSDLTPKDSGEYLCNISAP
HYTKLTVRTVRVENSDNSHTAWQIAVGVAIALAVIGVSGYFFFKACKKKGGRN
Download sequence
Identical sequences XP_009673374.1.43253 XP_009673376.1.43253 XP_009673377.1.43253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]