SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009677015.1.43253 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009677015.1.43253
Domain Number 1 Region: 629-884
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 18-277
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 328-563
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 4 Region: 932-1191
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-40
Family YWTD domain 0.0000367
Further Details:      
 
Domain Number 5 Region: 886-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1322-1360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1244-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 584-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000203
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1284-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 280-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000293
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1201-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009677015.1.43253
Sequence length 1513
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Struthio camelus australis]; AA=GCF_000698965.1; RF=representative genome; TAX=441894; STAX=8801; NAME=Struthio camelus australis; AL=Scaffold; RT=Major
Sequence
MSLSVPPHPLFLPFKAAPLLLYANRRDLRLVDAANGKENATVVVGGLEDAAAVDFVFVRG
LIYWSDVSEEAIKRTEFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIEVSN
LDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSVIVNTDIYW
PNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWN
THSILACSKYTGEDLREIHSNIFSPMDIHAFSQQRQPNATNPCGINNGGCSHLCLMSPTK
PSYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAI
AIDFDPLEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTG
TDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIV
LVNTSLGWPNGLALDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGD
YVYWTDWQRRSIERVHKQTAEREIIIDQLPDLMGLKATNVRQIIGTNPCAEDNGGCSHLC
LYRPQGLRCACPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKE
ASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWAD
TGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSER
TTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQD
YIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHL
CLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHS
LRNVRAIDYDPLDKQLYWIDTRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDI
YSRYIYWTCEATNVINVTRLDGRPMGVVLRGDQDRPRAIVVNPEKGYMYFTNLQERSPKI
ERAALDGTEREVLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSN
ILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNIQEYR
QHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDC
IPVAWRCDGFTECEDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQDNSDEKNCE
VLCLTDQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILT
VFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGK
SVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFG
YSSNSPSTHRSYR
Download sequence
Identical sequences XP_009677015.1.43253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]