SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009814355.1.37116 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009814355.1.37116
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 180-415
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-28
Family YWTD domain 0.0000529
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000205
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1174-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000404
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009814355.1.37116
Sequence length 1460
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X4 [Gavia stellata]; AA=GCF_000690875.1; RF=representative genome; TAX=37040; STAX=37040; NAME=Gavia stellata; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSSRAVIVNTDIYWPNGLTLDYEEQKLYWADAKLNFIHKSNL
DGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIFSPMDI
HAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKT
DKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQ
LPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELINDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSA
PTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRK
AQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVV
LKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALAIDS
QLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCP
VHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDT
QFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDC
SDSSDEQGCCNPPGEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMT
NDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASS
SSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYRPYSYRHFAPPTTPC
STDVCDSDYAPSRRVTAATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYT
ERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_009814355.1.37116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]