SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009822856.1.97551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009822856.1.97551
Domain Number 1 Region: 5-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-60
Family Capz alpha-1 subunit 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009822856.1.97551
Sequence length 284
Comment hypothetical protein H257_01385 [Aphanomyces astaci]; AA=GCF_000520075.1; RF=representative genome; TAX=112090; STAX=112090; NAME=Aphanomyces astaci; strain=APO3; AL=Scaffold; RT=Major
Sequence
MADVLSDAEKLNVAKGFLLASPPGEVRDVSKDVAKLLPRGLLSDTALRGILHTYNVENSL
PVQIPNVDESKRLVVCQEGEVDVGHYLDTHGRKVWGFDHVTQEILAQDVQDASARFTSSL
EPLRAELQVEVDAYLATQFGNQGGAAVFATDSTITIVLSTERVSLRNFWSGRWKSKWTLT
NVSPDAATLAGRIDLHVHYFEDGNLQLQSHKDVAPVPVTGESLAQAVLAVLRAEEHVVHS
NLEDMYINMTEETFKEMRRVMPVTQTKMEWNLYAHRTAKDLSRK
Download sequence
Identical sequences W4HA57
XP_009822856.1.97551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]