SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009853806.1.73169 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009853806.1.73169
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.79e-87
Family Capz alpha-1 subunit 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009853806.1.73169
Sequence length 269
Comment hypothetical protein NEUTE1DRAFT_48330 [Neurospora tetrasperma FGSC 2508]; AA=GCF_000213175.1; RF=representative genome; TAX=510951; STAX=40127; NAME=Neurospora tetrasperma FGSC 2508; strain=FGSC 2508; AL=Scaffold; RT=Major
Sequence
MASHKEIVSSFVEGAPPGELSDIKALTSSTPNLLNELGPAFQKYNEEQFATVKLPGGSQP
VIISSHSSLEDGRYYDVESSSSFAYDHITQKASDVQSHVLEGEQTDLVKSTVKGLSAYVK
EHFPNAAYGAYPIENDSKIAVVIVANKYSPNNFWNGRWRSLYIYDPSNNSIEGSIKVDVH
YYEDGNVRLLTNKTVTATVSSGTGSGIAKEISVNEKKYQEELNKSFTSLSEGAFKGLRRQ
LPVTRQKIEWDKVASYRLGQDIGGGSSRR
Download sequence
Identical sequences F8MUV1 G4V1X1
XP_009853806.1.73169 jgi|Neute1|72737|e_gw1.2.1080.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]