SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009904459.1.92783 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009904459.1.92783
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.28e-54
Family YWTD domain 0.00000464
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-51
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-38
Family YWTD domain 0.0000632
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-27
Family YWTD domain 0.0000979
Further Details:      
 
Domain Number 5 Region: 1172-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1135-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1095-1133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 8 Region: 739-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000355
Family EGF-type module 0.038
Further Details:      
 
Domain Number 9 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000045
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1051-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000804
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009904459.1.92783
Sequence length 1490
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Picoides pubescens]; AA=GCF_000699005.1; RF=representative genome; TAX=118200; STAX=118200; NAME=Picoides pubescens; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDSSARKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDI
QVLSPDRQPYFHTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLEDDGRTCKAGSEEVL
LLARRTDLRRISLDTPDFTDIILQIDNIRHAIAIDYDPAEGFLYWTDDDVRAIRRARLDG
SGAQTLLTAEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGSARRVLVSDSLDEPRAI
VLNPLLGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDLEKQKLYWGDAKT
DKIEVINIDGTMRRTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIKASRDIIIDQ
LPDLMGLKATSVSKVFGTNSCAENNGGCSHLCFFTPQEARCACPMGLELLSDLKTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFM
NGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQHRQVLLWKDLDNPR
SLALDPTKGFMYWTEWGGKPRIVRAFMDGTNSLTLVDKVGRANDLTIDYVDQRLYWTDLD
TSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLEPNSRNCTSP
ASFLLFSQKSAISRMIPDDQQSPDLILPLHGLRNVKALDYDPLDKFIYWVDGRQNIIKRA
KDDGSQPFTVMSTPSQSQNPEKQPHDLSIDVYSHTLYWTCEATNSVNVQRLSGEALGMVL
RGEHDRPRAIALNAERGYMYFTNMQERAPRIERAALDGTEREVLFTTGLLRPVALVVDNK
LGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEK
VNGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSRDNGGCSHICIAKGDGTPRCSCPE
HLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEQGCPLCSAAQ
FQCGRGQCIEAHLRCNGDIDCQDKSDEADCHTICLPSQFRCASGQCILLKQQCDSFPDCI
DGSDELLCEKTKPASDVSQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPF
PHDYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGAS
SSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRPYLLRGSAPPTTP
CSTDVCDSDCAPGRWKLGGSVLLALRGSSAQSMSSLLLILNPPPSPATDRSLYNAEMFYS
SNIPSTTRSYRQFKDRLCGVLVALKGAFPAFIGYIFIFFTKKMPPTFHRL
Download sequence
Identical sequences XP_009904459.1.92783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]