SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009939373.1.35112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009939373.1.35112
Domain Number 1 Region: 595-850
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-55
Family YWTD domain 0.00000515
Further Details:      
 
Domain Number 2 Region: 6-243
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-52
Family YWTD domain 0.00000298
Further Details:      
 
Domain Number 3 Region: 294-524
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-49
Family YWTD domain 0.00000244
Further Details:      
 
Domain Number 4 Region: 897-1156
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-39
Family YWTD domain 0.0000484
Further Details:      
 
Domain Number 5 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 1249-1285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1208-1248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 853-898
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family EGF-type module 0.039
Further Details:      
 
Domain Number 9 Region: 551-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 248-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1165-1218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000093
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009939373.1.35112
Sequence length 1567
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Opisthocomus hoazin]; AA=GCF_000692075.1; RF=representative genome; TAX=30419; STAX=30419; NAME=Opisthocomus hoazin; AL=Scaffold; RT=Major
Sequence
MKLESTVVVSGLEDAAAVDFQYSQGIVFWTDVSEEAIKQTYINQTGNVAQNVIISGLVSP
DGLACDWIGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDW
GETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQ
KVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDIQVLSPD
RQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEVLLLARRT
DLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTL
ITTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPVM
GYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDLEKDKLYWGDAKTDKIEVI
NVDGTMRKILLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIKASRDIIIDQLPDLMG
LKATSVTKVLGTNSCAENNGGCSHLCFFTPQETRCACPIGLELLSDLKTCIIPEAFLVFT
SRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFMNGSSVE
HVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDP
TKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLDTSMIES
SNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQGQLDFVM
DILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLF
SQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLDNLIYWVDGRQNIIKRAKDDGTQ
PFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDK
PRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFW
VDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKMNGYKR
TRIQGRIAHLTGIHAVEELDMEEFSVHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQ
NLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKG
QCIDAHLRCNGEIDCQDKSDEVDCDTVCLPNQFRCASGQCILLKQQCDSFPDCIDSSDEL
MCEKTKPASDESQPHSSAIGPVIGIILSLFVMGGMYFICQRVVCQRYAGPNSPFPHEYVS
RTPHVPLNFIAPGSSQHGTFTGISCGKSVISSMSLMGGSSGAPLYDRNHVTGASSSSSSS
TKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVC
DSDYTTSRWKANKYYMDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPP
SPCTDSS
Download sequence
Identical sequences XP_009939373.1.35112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]