SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009977566.1.11325 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009977566.1.11325
Domain Number 1 Region: 312-389
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-20
Family PCI domain (PINT motif) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009977566.1.11325
Sequence length 420
Comment PREDICTED: 26S proteasome non-ATPase regulatory subunit 12, partial [Tauraco erythrolophus]; AA=GCF_000709365.1; RF=representative genome; TAX=121530; STAX=121530; NAME=Tauraco erythrolophus; AL=Scaffold; RT=Major
Sequence
EGRLQEVIENLLSLEKQTRTASDMVSTSRILVAIVKMCYEAKDWDALNENIILLSKRRSQ
LKQAVAKMVQQCCTYVDDITDLPVKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQN
GEVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQE
ENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVIL
SPYDNEQSDLVHRISSDKKLEEIPKYKDLLKLFTTMELMRWTALVEEYGKELREGSLDSP
ATDVFGCTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEEFLSNL
VVNKTIFAKVDRLAGIINFQRPKDPNNILNDWSHKLNSLMALVNKTTHLIAKEEMIHNLQ
Download sequence
Identical sequences A0A093C3F7 U3IIH9
ENSAPLP00000007051 XP_009977566.1.11325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]