SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_009992452.1.85724 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009992452.1.85724
Domain Number 1 Region: 47-176
Classification Level Classification E-value
Superfamily FKBP-like 1.47e-39
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 2 Region: 238-372
Classification Level Classification E-value
Superfamily FKBP-like 1.28e-34
Family FKBP immunophilin/proline isomerase 0.00048
Further Details:      
 
Domain Number 3 Region: 1-53
Classification Level Classification E-value
Superfamily FKBP-like 9.62e-17
Family FKBP immunophilin/proline isomerase 0.0016
Further Details:      
 
Domain Number 4 Region: 391-455
Classification Level Classification E-value
Superfamily EF-hand 0.000000000017
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009992452.1.85724
Sequence length 469
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP10 [Chaetura pelagica]; AA=GCF_000747805.1; RF=representative genome; TAX=8897; STAX=8897; NAME=Chaetura pelagica; AL=Scaffold; RT=Major
Sequence
MDRGLQGMCVNERRHLIVPPHLGYGSIGVAGLIPPDATLYFDVVMLDIWNKKDKLQITTL
SRPKHCNRTVENSDFVRYHYNGTLLDGTPFDSSYSKDSTYDTYVGTGWLIKGMDQGLLGM
CAGEKRSIIIPPFLAYGEKGYGTVIPPQASLVFSVLLVDFHNPKDGVFLEHLEVPESCQR
RAVTGDFVRYHXXXXXXALRLQVWVGKVGVGRSLMSPPAPRSAARSSWIIRKEGEGEGDT
GQGNKIPGSAVLIFDVHIIDFHNPADPVEIQTVYRPEGCNTTTRHRDFVRYHYNCSLLDG
TRLFSSHDYEKPQEVTLGANKVIEGLNSGLLNMCAGERRVLIVPPHLGHGESGARGVPGS
AVLRFEVELISMEEGVPEGYLFIWHGDPPANLYEEMDLNKDGEIPADEFSTFIKTQVAEG
KGRLMPSSDPEKVIADMFRNQDRNQDGKITSEELKLKSDEDQEKVHEEL
Download sequence
Identical sequences XP_009992452.1.85724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]