SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010047548.1.83385 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010047548.1.83385
Domain Number 1 Region: 286-389
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000249
Family Ankyrin repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 87-206
Classification Level Classification E-value
Superfamily POZ domain 0.000000000126
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010047548.1.83385
Sequence length 541
Comment PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 isoform X2 [Eucalyptus grandis]; AA=GCF_000612305.1; RF=representative genome; TAX=71139; STAX=71139; NAME=Eucalyptus grandis; cultivar=BRASUZ1; AL=Scaffold; RT=Major
Sequence
MPSPPPPPLAPLRPRAFAPMDAGRSALSDSNEIISNSSSIYCAPTANTSSLSSSRAAAPA
DGASLVRLSDHLESIFAAEHGGGGDFDFFADAKIALADGRQVPVHRCILSGRSGFFRGAF
TRGATKLEVKELGKDFEIGHDALMAVLGYLYSGKVKPPPPAARECVDEECPHAACRPAVD
FLIQVLYAAFTFQISELVGLYQMDLLDILDKVAIDDLLVVLSVANMCSNACEGLSARCIE
IVVKSNVDVVTLDRALPHFIVKQIVDARMELGLNRPGCDSFPDKHVKRIHRALDSDDVEL
VRMLLREAHTTLDHACALHYAVAYCDAKTTTELLDLGIADVNERNPRGYTVLHVAALRKE
PKIIVSLLVKGARASDLTLDGRKALQISKRLTRAVDYYKSTEEGKATSEERLCVEILEQA
ERRDPLLGEAALSLAIAGDDLRKKLLYLENRVALAKLLFPIEAKVAMDIAQVDETSEYPL
VSIQNLARKQGANVDLNEAPFKIQEEHLNRMRALSKTGQKLGLNWLMGLTGCFINLQAAG
P
Download sequence
Identical sequences A0A059CMP5
Eucgr.C00872.2|PACid:23570417 XP_010047548.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]