SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010053022.1.83385 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010053022.1.83385
Domain Number 1 Region: 59-254
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.35e-43
Family FAD-linked oxidases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010053022.1.83385
Sequence length 538
Comment PREDICTED: flavin-dependent oxidoreductase FOX2 [Eucalyptus grandis]; AA=GCF_000612305.1; RF=representative genome; TAX=71139; STAX=71139; NAME=Eucalyptus grandis; cultivar=BRASUZ1; AL=Scaffold; RT=Major
Sequence
MAFRSSLLLSQILFLFVALPSSWTSATSTIQQTFFRCLSTNSMNSIPLSTYYTPNNVTSF
TSVLNSTANNLRYLLPNAPKPVIIFTPLCEAHVQAAVLCSRRFGLALRVRSGGHDYEAVS
YVSQIESPFLVLDLARLRSIQVDIRRGTAWAQAGATTGEVYYRIAQQSRVHGFPMGLCAS
LGVGGHITGGAYGSMMRMFGLGVDNVIDVRMVDSKGRILDRKAMGEDLFWALRGGGGGSF
GVILAWNLKLVNVPETVTVFTVTKTLEQGATKLLYKWQKVAPKIDDRLYIRVIIQASSAD
LTANRTVVTSYNALFLGDPDTLLRIMGKRFPELGLTRADCVKTSWIGSVLYIAGYPNTTA
PEVLLQGKPLFRNYFKAKSDFVRTPISVKGLLGLWKIYLQEENPFMIWNPYGGAMARVPE
SATPFPHRYGTLFKIQYVATWQDGTQSMARHMNWLTKLYNYMGSYVSKNPREAYVNYRDL
DLGMNKKGVNSLAEASSWGLRYFKSNFYRLVQVKTRVDPDNFFRHEQSIPPLPVKRGR
Download sequence
Identical sequences A0A059CFL2
XP_010053022.1.83385 Eucgr.D01619.1|PACid:23575370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]