SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010073190.1.40768 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010073190.1.40768
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.41e-65
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 2092-2208
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-37
Family Pleckstrin-homology domain (PH domain) 0.00000337
Further Details:      
 
Domain Number 3 Region: 195-316
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 1439-1595
Classification Level Classification E-value
Superfamily Spectrin repeat 6.89e-30
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 911-1066
Classification Level Classification E-value
Superfamily Spectrin repeat 8.14e-30
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 6 Region: 503-626
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-29
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 7 Region: 1123-1276
Classification Level Classification E-value
Superfamily Spectrin repeat 2.54e-28
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 8 Region: 1758-1912
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 711-851
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 594-714
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-26
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 11 Region: 325-428
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 1598-1703
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 13 Region: 429-537
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 14 Region: 1284-1382
Classification Level Classification E-value
Superfamily Spectrin repeat 7.05e-18
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 15 Region: 1893-1978
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000183
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010073190.1.40768
Sequence length 2262
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1, partial [Pterocles gutturalis]; AA=GCF_000699245.1; RF=representative genome; TAX=240206; STAX=240206; NAME=Pterocles gutturalis; AL=Scaffold; RT=Major
Sequence
PKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQ
DISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLI
DFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKM
KALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQ
LQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLE
KAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAA
TKKHEAIETDIAAYEERVQAVVAVAKELETENYHDIKRITARKDNVIRLWEYLLELLRAR
RQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQ
AERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRL
WKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLLSKHKAFEDEMSGRSGHFQQAIKE
GEDMIAEEHFGSEKIRERIKDIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWM
LDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEIASYRPTIDTLHEQAKALPQEHAGSPDV
QGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEKWLNNMQIPEK
LEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQF
RELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTG
MERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEINDVWEEMKATLKNREESLGE
ASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQK
MRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQ
AEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGN
INSDKIQEKVDSIDDRHKKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQD
MSYDEARNLHSKWLKHQAFMAELASNKEWLEKIEKEGMQLIAEKPETEAVVKEKLTGLHQ
MWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLK
KQQMLENQMDVRKKEIEELQSQARALSQEGKSTDEVDGKRLTVEKKFLELLEPLNERKAN
LLASKEIHQFNRDVEDEILWVGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR
IDDIFERSQNIITESSPNAEAIQQRLADLQQLWNLLIEETEKRHKRLEESHRAQQYYFDA
AEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRTLVAD
NHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVA
GSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKD
GLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRIQDKHKKLPEELGRDQNTVET
LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACE
GRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEID
ARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQ
FSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFAALERLTT
LELLEVRRQQEEEERKRQPPTPEPSPKVAEDGDSQQQWDGTKGEQVSQNGLPSDQESPRV
AETAETNEMVNGAAEQRTSSKESSPVPSPTADRKAKTAVQAQTAATLPAKTQEIPSAQMA
GFLHRKHEWETHSKKASSRSWHNVYCVINNQEMGFYKDSKAASSGIPYHNEIPVSLKEAV
CEIAVDYKKKKHVFKLRLTDGNEYLFQAKDDEEMNTWIQAITSAISSDKIEVSPTTQSTP
ASSRAQTLPASVTITSESSPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences XP_010073190.1.40768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]