SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010163294.1.30499 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010163294.1.30499
Domain Number 1 Region: 78-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 2 Region: 127-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000445
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010163294.1.30499
Sequence length 206
Comment PREDICTED: low-density lipoprotein receptor class A domain-containing protein 1 [Antrostomus carolinensis]; AA=GCF_000700745.1; RF=representative genome; TAX=279965; STAX=279965; NAME=Antrostomus carolinensis; AL=Scaffold; RT=Major
Sequence
MNKTHPQRNGDVATFDSTKSFSKERGCCLPGSARAGCTRRRACISAMALLLLAATVGLAL
ALGLLPRAPVNRFCATSNNRTGFLCDDSVTCVPASQVCDRVSNCRNGEDEQEKLCGDLPH
SLPGYLVFRCSNPTHWVYADRRCNGMNDCGDCSDEMGSLAACPPCGLEWWSCNPVFYEYC
SCIPRRLCRDGVQHCISWSDEYICRP
Download sequence
Identical sequences XP_010163294.1.30499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]