SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010182337.1.17318 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010182337.1.17318
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2197-2313
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-37
Family Pleckstrin-homology domain (PH domain) 0.00000295
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 603-733
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-30
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 5 Region: 1544-1700
Classification Level Classification E-value
Superfamily Spectrin repeat 7.52e-30
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 6 Region: 1016-1170
Classification Level Classification E-value
Superfamily Spectrin repeat 8.14e-30
Family Spectrin repeat 0.0000235
Further Details:      
 
Domain Number 7 Region: 1228-1381
Classification Level Classification E-value
Superfamily Spectrin repeat 3.82e-28
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 8 Region: 1863-2017
Classification Level Classification E-value
Superfamily Spectrin repeat 2.29e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 694-814
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-26
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 10 Region: 811-945
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 11 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 1703-1808
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 13 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 14 Region: 1389-1487
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-18
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 15 Region: 2022-2083
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000389
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010182337.1.17318
Sequence length 2367
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X1 [Mesitornis unicolor]; AA=GCF_000695765.1; RF=representative genome; TAX=54374; STAX=54374; NAME=Mesitornis unicolor; AL=Scaffold; RT=Major
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVAKELETENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQI
LSSDDYGKDLTSVVRLMSKHKAFEDEMSGRSGHFQQAIKEGEDMIAEEHFGSEKIRERIK
DIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ
SLVKKHKDVAEEIASYRPTIDSLHEQAKALPQEHAGSPDVQGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEKWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDXXXXXXXXXXXLSAL
SIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDL
QKEAEKLESEHPDQAQAILSRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQ
SWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDA
QYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHT
EMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDD
RHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLK
HQAFMAELASNKEWLEKIEKEGMQLIAEKPETEAVVKEKLTGLHQMWEELESTTQTKAQR
LFDANKAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKE
IEELQSQARALSQEGKSTDEVDGKRLTVEKKFLELLEPLNERKANLLASKEIHQFNRDVE
DEILWVGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITES
SPNAEAIQQRLADLQQLWNLLIEETEKRHKRLEESHRAQQYYFDAAEAEAWMSEQELYMM
SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKV
DKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTML
QERFREFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDT
RTQILAASYELHKFYHDAKEILGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQAL
GTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRF
FSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKS
LLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQ
EPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFAALERLTTLELLEVRRQQEEEER
KRQPPTPEPSPKVAEDADSQQQWDGTKGEQVSQNGLPSDQESPRVAETAETNEMVNGAAE
QRTSSKESSPVPSPTSDRKAKTAVQAQTAATLPAKTQEIPSAQMEGFLHRKHEWETHSKK
ASSRSWHNVYCVINNQEMGFYKDSKAAASGIPYHNEIPVSLKEAVCEIAVDYKKKKHVFK
LRLTDGNEYLFQAKDDEEMNTWIQAITSAISSDKIEVSPTTQSTPASSRAQTLPASVTIT
SESSPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences XP_010182337.1.17318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]