SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010213249.1.20684 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010213249.1.20684
Domain Number 1 Region: 570-825
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 5-222
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-50
Family YWTD domain 0.00000226
Further Details:      
 
Domain Number 3 Region: 273-504
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-47
Family YWTD domain 0.00000397
Further Details:      
 
Domain Number 4 Region: 873-1132
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 827-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000898
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1263-1302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1185-1223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 525-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000261
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1225-1261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 225-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000281
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1142-1195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000266
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010213249.1.20684
Sequence length 1469
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Tinamus guttatus]; AA=GCF_000705375.1; RF=representative genome; TAX=94827; STAX=94827; NAME=Tinamus guttatus; AL=Scaffold; RT=Major
Sequence
MFAQGLIYWSDVSEEAIKRTEFNKSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNR
IEVSNLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRAIIVN
TDIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLY
WTDWNTHSILACSKYTGEDLREIHSNIFSPMDIHAFSQQRQPNATNPCGINNGGCSHLCL
MSPTKPSYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLED
IRHAIAIDFDPLEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLY
WTDTGTDRIEVTRLRKILIAEELEEPRAIVLDPVAGYMYWTDWGEIPKIERAALDGSDRI
VLVNTSLGWPNGLALDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLG
DYVYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATSVQQITGTNPCAEDNGGCSHL
CLYRPQGLRCACPIGLELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK
EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWA
DTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSE
RTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQ
DYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSH
LCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIH
SLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSID
IYSRYIYWTCEATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPK
IERAALDGTEREVLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDS
NILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNVQEY
RLHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEID
CIPVAWRCDGFTECEDHSDEKNCPVCSEAQFQCESGQCIDSALRCNGEANCQDNSDEKNC
EVLCLTDQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQSNNTIGSIIGVIL
TVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRG
KSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEF
GYSSNSPSTHRSYSYRPYSYRHFAPPTTP
Download sequence
Identical sequences XP_010213249.1.20684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]