SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010214364.1.20684 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010214364.1.20684
Domain Number 1 Region: 73-184
Classification Level Classification E-value
Superfamily FKBP-like 1.3e-36
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 2 Region: 188-294
Classification Level Classification E-value
Superfamily FKBP-like 9.43e-34
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 3 Region: 3-76
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-24
Family FKBP immunophilin/proline isomerase 0.0011
Further Details:      
 
Domain Number 4 Region: 297-374
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000281
Family Calmodulin-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010214364.1.20684
Sequence length 387
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9, partial [Tinamus guttatus]; AA=GCF_000705375.1; RF=representative genome; TAX=94827; STAX=94827; NAME=Tinamus guttatus; AL=Scaffold; RT=Major
Sequence
SHNRMRTYDTYVGIGWLIPGMDQGLLGMCVGEKRIITIPPFLAYGEEGDGKEIPGQASLV
FDVALLDLHNPKDGVAVEQQHVPERCERRSQAGDFVRCHYNGTLLDGTLFDSSYARNRTY
DTYVGKGYVIAGMDEGLLGVCIGERRRITIPPHLGYGEEGRGKIPGSAVLIFDIYVVDFH
NPSDSVGITVTYKPSNCSVLSKKGDYLKYHYNASLLDGTLLDSTLSLGKTYNIVLGSGQV
VVGMDMGLQDMCVGERRRVVIPPHLGYGEEGVEGEVPGSAVLVFDIELLELVSGLPEGYM
FVWNGEVSPNLFEEIDQNHDGEVLLDEFSEYIQAQVDSGKGKLAPGFDFEKIVRNMFSNQ
DRDGNGKVTAEEFKLKDQEAKEEHDEL
Download sequence
Identical sequences XP_010214364.1.20684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]