SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010228150.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010228150.1.954
Domain Number 1 Region: 317-544
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.47e-78
Family CAT-like 0.0000246
Further Details:      
 
Domain Number 2 Region: 120-216
Classification Level Classification E-value
Superfamily Single hybrid motif 1.57e-26
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000803
Further Details:      
 
Domain Number 3 Region: 252-297
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.00000000000824
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010228150.1.954
Sequence length 544
Comment PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial-like isoform X3 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MALLLRHSRKLRRVHGVLDCERGSIARHFSASACSTTLKKEDGVSNSSLEYGKKAGSLSI
SQDRKSGKDTHKFKQVSPQEARGLYSSNRVLISATGVNSLFSCGQVVLARHFSSAADLPA
HEEIGMPSLSPTMTEGNIARWVKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVC
GDGAKEIKVGEIIAITVEEEGDIEKFKDYKAPASSAAPAESKPQSESTEPKGEEKELPKA
AEPKATKTEESSHSGDRVFSSPIARKLAEDNNVPLSSLKGTGPDGRILKADIEEYLSSEA
KGTKKEAAAAPGLGHVDLPNSQIRKVTANRLLKSKQTIPHYYLTVDSRVDELIKLRSELN
PLQDASGGKKISINDLVIKAAALALRKVPECNSSWMNDFIRQYHNVNINVAVQTEHGLFV
PVVRDADKKGLATIADEVKQLALRARDNSLKPEDYEGGTFTVSNLGGPFGIKQFCAIVNP
PQAAILAIGSAEKRVIPGTDGQFEVGSFMSATLSCDHRVIDGAIGAEWLKAFKGYLENPT
TMLL
Download sequence
Identical sequences I1H225
EG:BRADI1G52260.1 XP_010228150.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]