SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010228824.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010228824.1.954
Domain Number 1 Region: 294-577
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.72e-76
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 29-194
Classification Level Classification E-value
Superfamily L domain-like 2.19e-38
Family Polygalacturonase inhibiting protein PGIP 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010228824.1.954
Sequence length 592
Comment PREDICTED: LRR receptor-like serine/threonine-protein kinase FEI 1 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MGSFLRKQPSLLFILIILHFSAREAGSLSSDGEALIAFKKAITNSDGVFLNWREQDADPC
NWKGVRCNNHSKRVIYLILAYHKLVGPIPPEIGRLNQLETLSLQGNSLYGVLPPELGNCT
KLQQLYLQGNYISGYIPSEFGDLVELQALDLSSNSLRGSIPHSLDKLTKLASFNVSMNFL
TGAIPSDGSLVNFNETSFIGNLGLCGRQINSVCKDALPSPSSQQSNPDDIINSKAGRNST
RLIISAVATVGALLLVALMCFWGCFLYKSFGKKDIHGFRVELCGGSSVVMFHGDLPYSTK
DILKKLETMDDENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGRDRFFDRELEILGSV
KHRYLVNLRGYCNSPSSKLLIYDYLPGGSLDEVLHEKSEQLDWDARINIILGAAKGLAYL
HHDCSPRIIHRDIKSSNILLDSNFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYM
QSGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGESREREIADPNC
EGMQAETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVITPCPSDFYDSE
Download sequence
Identical sequences I1H742
XP_003558273.1.954 XP_010228824.1.954 15368.BRADI1G67050.2 EG:BRADI1G67050.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]