SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010229351.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010229351.1.954
Domain Number 1 Region: 419-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-65
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 722-791
Classification Level Classification E-value
Superfamily RING/U-box 4.68e-20
Family U-box 0.0049
Further Details:      
 
Domain Number 3 Region: 19-141
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000327
Family Universal stress protein-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010229351.1.954
Sequence length 795
Comment PREDICTED: U-box domain-containing protein 35-like isoform X4 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MAIQEEGEGAGSADAPLTVGLALGGSKSSTYVFRWALAKFANGKDKPAPIFKLIHVLTPV
LAVPTPLGNYIPIDEVRPDIAEAYAKEVHVQAQEMLLPYRKMCDENKVEVEVLLVKGDDV
ADTISNLVTQYKIRVLVVGNPTSRSAFTRKSSGNKASSKICKSIPSFCTTYIVSKDGLSS
VYSPGLGSETSSCRSSDSQAFSGEMSLRSDLSDSSARTLLGLLSLPSSNLASENLKSSSS
AERNRSFTLYDYISGSASVYADKDRRITSCTDSESSISSRLRASNKAPTQGSSLRGLMLS
ETKDDVNIELEKLRLELRHVQGAHKLVQDESADASRQVVELAAKRVEGKAQLREIQSRVD
KANDEVQEEKARRCATEEVVTHVKDLVRAEVMQKNRLLIKASKVADQKSRLEELFVLHGN
SYSTFTWEEIDNATSSFSESRKIGAGSNGTVYKGHLNHLDVAIKVLHSDDRSSTKHFNQE
LEVLGRIRHPHLLMLLGACPDRGCLVYEYMENGSLADRLQCKNGTPSIPWFHRFRIAWEI
VSALVFLHSTKPNPIIHRDLKPENVLLDRDLVSKIGDVGLSTLVPLKDSSSSGTMYKKTG
LAGTMFYIDPEYHRTGQVSVKSDTYALGMVILQLLTARSPIGLPELVERAVEDDQLMDVL
DEGAGNWPAKEAHDLAQLGLSCLEMRSKNRPDLKNMVSVELERLKGIAIVASGPVQVVPG
LGPPSHFLCPILKTVMQDPCIAADGHTYERNAILMWLCEHDVSPVTKALLPNKTIVSNQS
LLSAISSWRSQGGGL
Download sequence
Identical sequences I1HAU9
EG:BRADI1G78380.1 15368.BRADI1G78380.1 XP_010229351.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]