SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010229918.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_010229918.1.954
Domain Number - Region: 125-192
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000189
Family NRPS condensation domain (amide synthase) 0.048
Further Details:      
 
Domain Number - Region: 211-342
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000289
Family NRPS condensation domain (amide synthase) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010229918.1.954
Sequence length 442
Comment PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MAKVEVLATELVVPAGETPGGSIWLSNLDLAARRGYTPTVYFYRPKNHGAVDPEEAFFAA
GAVKCSLAKALVAFYPLAGRLGLDDAAGRLQIDCTGEGAVLVTARSDHYALDELMSEFVP
CGEMRDLFVPATPAPNPPCALLLAQVTRLRCGGVVLGLALHHSVVDARSAAHFVETWASI
SRGNHQDAPLVPPCFDHRLLDARPYPARAVLYDHPEYKPEPAPVDVTPVSASTYASAIIT
VSKKQVAALRARCAGASTFRAVVALVWQCACRARALAPGAETRLYSMIDMRPRLAPPLPQ
GYFGNAVVRTSAVVTVDEVVSSPVAYGARRARAATSQGDDYARSLVDYLETVDTMNLPRS
GISRAHLRAISWMGMSLSDADFGWGAPAFMGPALMYYSGFVYVMNAPGKDGAVALALSLE
PDSMPEFKKTFADELARLEVEV
Download sequence
Identical sequences I1H0A6
EG:BRADI1G47190.1 15368.BRADI1G47190.1 XP_010229918.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]