SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010230347.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010230347.1.954
Domain Number 1 Region: 318-614
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-81
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010230347.1.954
Sequence length 682
Comment PREDICTED: proline-rich receptor-like protein kinase PERK9 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MASSPSAAVAPTGTPSPAAATTPASPAPVKLPNATPADPPASPPAAAAVPPPQPTSPPPP
TPTPPPATVPPPPVVVASPPPTPSAALPPPSPPTAVPPPPAGAAPPKPSPLRPPAAASPP
PSQSNLPPPNPPDSSTTPPVAQSPPPPHRRSPRPPTTEPQAPPPSASVITPPTSPSPASG
DPIMPNSTSTSPPTPSAPGSAPSDTADKPTTQPTFGISNPAPNKPWSPSVQDSSPSPSGD
GVSYGAKVGIGVVVAILVLSLVGAAFWYKKKRRRMTGYHAGFVMPSPSPSSSPQVLLGHS
EKTKTNHTAGSHDFKDAMSEYSMGNCRFFTYEELHKITNGFSAQNLLGEGGFGSVYKGCL
AEGRLVAIKKLKDGSGQGEREFQAEVEIISRVHHRHLVSLVGYCISGDQRLLVYDFVPND
TLDYHLHGRGVPVLEWSARVKISAGSARGIAYLHEDCHPRIIHRDIKSSNILVDNNFEAQ
VADFGLARLAMDFATHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKP
VDASNPLGDESLVEWARPLLTEALGTGNVGELLDPRLDNNFNEVEMFRMIEAAAACIRHS
ASRRPRMSQVVRALDNLADVDLTNGVQPGKSEMFNAPDTAEIRLFQRMAFGSQDFTTDFT
QSSWNSHQSRDVDASALRHSQS
Download sequence
Identical sequences I1HB93
15368.BRADI2G00900.1 EG:BRADI2G00900.1 XP_003565837.1.954 XP_010230347.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]