SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010231814.2.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010231814.2.954
Domain Number 1 Region: 720-1004
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-72
Family Protein kinases, catalytic subunit 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010231814.2.954
Sequence length 1062
Comment PREDICTED: wall-associated receptor kinase 3-like isoform X2 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MAMSLVVMAVAPLLLLSSLAGAELNPGEAIGMPNCDIDCGHMKVPYPFGMGPARCYWPGF
KLTCNRTGKSKTPRLLLGDGTGTLGQVEDLYLRSPFLSVTRTGSVEIDAAGKGALGSSVG
EDGPYTLASRANELTLTGCNVQVTLKNGNITMASCSSVCESYGLTTTTPEILTRDSLPCS
GSRCCQVDIINQIMARGKDRLVYAASYNVEVTHFGLNRSSDESRVPTRVFVARKGWFEQV
WLATDHPDRPNRTPSEDATLRVPIWLEWEVLGDSIEPADRNRTAVQCPAEADRRICKSNN
STCSRATVGYTCFCDDGFEGNPYVTDGCKDRCYYGDLIDTANCTCPLGTQGDPYQRGGCI
GLITGGCRHICGNVSAPYPFGVGQGHDCYQEGFNLTCIDTGHEPARLFLDSDMVTQVLEI
SIRNNTVRVLDTGVVSTNISRPTEGNTDEFEGSFELSTYGHEELPYSLSTHNELILTGCN
LMAELSWESDGGIVSVCGSFCSYNDIKQDDQCNGMGCCRTRISMYNNSMRSQFKYKLKWF
NKGDTAPDREKSAPIHILIAEEGRFNQGQISSKLPSEPVNIPILLQWEVLRGFSTASVVK
SSRSDCPREVSDRLCRSKHSYCKRGSRGGYTCHCRTGYDGEPDANPYVSDGCKGHNLSTT
GKYIIIGVGIGAGVILSLFAASSISKKLKDRRAQILKRQFFENNRGQLLRQLVSQRADIA
ERMIITLEEIEKATNNFDKARELGGGGHGTVYKGILSDLHVVAIKKPKMVVQKEIDEFIN
EVAILSQINHRNVVKLYGCCLETEVPLLVYEFISNGTLYEHLHTGESRSLSWDGRLRIAV
ETAKSLAYLHSTASVPVIHRDVKSVNILLDDTLTAKVADFGASRYVPMDRSGVTTMVQGT
IGYLDPMYFYTQRLTEKSDVYSFGVILVELLTRKKPSSYMSPEGDGLVAQFATLFAEGNL
SEILDPQVVDEGSKEVEAVATLAVTCVKLRGEDRPTMRQVELTLEAVRASNQDGLASTGD
EKFEENVIALNCPQADDAMSTEESTRQVSMEEELLLSSRYPR
Download sequence
Identical sequences I1HMN4
XP_010231814.2.954 15368.BRADI2G38280.1 EG:BRADI2G38280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]