SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010234242.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010234242.1.954
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.26e-33
Family Canonical RBD 0.00067
Further Details:      
 
Domain Number 2 Region: 108-144
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000297
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010234242.1.954
Sequence length 226
Comment PREDICTED: glycine-rich RNA-binding protein RZ1A [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MSDADEYRCFVGSLSWSTTDVDLKDAFGKFGRVTETKVVLDKYSGRSRGFGFVTFDDKKA
MEEAVEAMNGIDLDGRNITVERAQPQGSGRDRDGDYRGGGGDYGRDRGRDFGGGRGGGGR
GGGGDCYKCGKPGHFARECPSGDGGDRYGSRDDRYGGRDDRYGGRDSGRDDRYGGSNGSS
RYGPDRGGDRYSGSRDGGSRSGGGGGGDRYSRDRSGPYERRSRDGY
Download sequence
Identical sequences I1I099
XP_010234241.1.954 XP_010234242.1.954 XP_014756466.1.954 15368.BRADI3G13040.4 EG:BRADI3G13040.1 EG:BRADI3G13040.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]