SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010235006.2.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_010235006.2.954
Domain Number - Region: 67-187
Classification Level Classification E-value
Superfamily Caspase-like 0.000387
Family Gingipain R (RgpB), N-terminal domain 0.054
Further Details:      
 
Domain Number - Region: 3-34
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0361
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010235006.2.954
Sequence length 355
Comment PREDICTED: metacaspase-1 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MMMLVNCSGCRTPLQLPHGAPCIRCAICGAVTHVAAPPAAAPSPDPARGAVAPSWGPPPP
AAHGRKRAVICGISYRFSRHELKGCINDAKCMRHLLTTRFSFPDDSIIMLTEEQTDPYKI
PTKHNIRMAMYWLLQGSQPGDSLVFHYSGHGAQQRSYSGDEVDGMDETLCPLDFETQGMI
VDDEINAALVRPLPHGAKLHALIDACHSGTALDLPFLCRMNRSGQYIWEDHRPRSGVWKG
TSGGEAISFSGCDDNQTSADTSALSKITSTGAMTFCFIQAIERGQGTTYGSILNSMRATI
RNTGGGGDSLAGGGAVTSLISMLLTGGSASTGGLRQEPQLTACDTFDVYAKPFSL
Download sequence
Identical sequences I1I697
EG:BRADI3G33722.2 XP_010235006.2.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]