SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010235146.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010235146.1.954
Domain Number 1 Region: 1-235
Classification Level Classification E-value
Superfamily 14-3-3 protein 3.66e-104
Family 14-3-3 protein 0.00000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010235146.1.954
Sequence length 256
Comment PREDICTED: 14-3-3-like protein GF14-C [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MSREDNVYMAKLAEQAERYEEMVEYMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRAS
WRIVSSIEQKEEGRGNEDHVTLIKDYRGKIEAELSKICDGILKLLDSHLVPMSTAAESKV
FYLKMKGDYHRYLAEFKASAERKEAAESTMVAYKAAQDIALAELAPTHPIRLGLALNFSV
FYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEEG
AEEGKEASKGEAGEGQ
Download sequence
Identical sequences I1I791
XP_003574509.1.954 XP_010235146.1.954 EG:BRADI3G36480.2 15368.BRADI3G36480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]