SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010237794.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010237794.1.954
Domain Number 1 Region: 142-436
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-92
Family Protein kinases, catalytic subunit 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010237794.1.954
Sequence length 640
Comment PREDICTED: probable serine/threonine-protein kinase At1g54610 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MKIHIRFLRSSGKALNVFVGHLCSKCTRQDDGGTSRSQGTGTMCVHGLYTPSSKEGQSAT
VAKVADDEGNTEVPNVQLKEKSVIGFDPPRKPSARHRLKIWISTRHNGITGRYGNKSAEH
ANIGWPDWLVNVAPEAVQGWQPLQVDSFEKLSKIGQGTYSSVYKARDLRTGKVVALKKVR
FVSTDPESVRFMSREISVLRKLNHPNVIKLEGIVTSSVSQNLYLVFEYMEHDLVGLAATP
GLKFTEPQVKCLFQQILSGLDHCHSNGVLHRDMKGSNLLIDSNGVLKIADFGLATFYDPG
TQQPLTSRVATLWYRPPELLLGATRYSVGVDMWSTGCIFAELLAGKPIMPGRTEVEQIHK
IFKLCGSPSEEYWQNLEVPPTGVIKPRCQYKRCIAENFKDLPPSALGLIDNLLALEPETR
GTAALTLQSDFFRTEPLACSPSSLPKCPPSKEYDARLRLEEARRERKAESVRPGIENTRK
NRSAYGPINSKRLAHTKTKFKKVNLNPEDDPSTLATQVQPLGFDSTWNNKGGNNYTDNGE
VPARKYRSARVANSIVSRTEGGPDMLQPESTDMRNGMPASHNRSTGAKVPMVKYKGKKSK
IHYSGLLIKPDGNLDVVLREHERNIQEAVRQTRLDKSREL
Download sequence
Identical sequences I1IMA3
EG:BRADI4G21250.1 XP_010237792.1.954 XP_010237793.1.954 XP_010237794.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]