SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010237970.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010237970.1.954
Domain Number 1 Region: 9-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-93
Family Protein kinases, catalytic subunit 0.0000047
Further Details:      
 
Domain Number 2 Region: 335-425
Classification Level Classification E-value
Superfamily KA1-like 0.0000589
Family Kinase associated domain 1, KA1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010237970.1.954
Sequence length 439
Comment PREDICTED: CBL-interacting protein kinase 32 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MSTTKVKRRVGKYELGRTIGEGTFAKVKFARDTETGDPVAIKILDKEKLLKHKMVEQIKR
EIATMKLIKHPNVVRMHEVMASKTKIYIVLEYVTGGELFDTIVNHGRMREDEARRYFQQL
INAVDYCHSRGVYHRDLKPENLLLDSCGNLKVSDFGLSALSQQLKDDGLLHTTCGTPNYV
APEVLEDQGYDGAMADLWSCGVILFVLLAGYLPFEDSNLMNLYKKISNAEFTFPPWTSFP
AKRLLTRILDPNPMTRITIQEMLEDEWFKKGYKRAEFDEKYDTTLDDVDAVFNDLEEHHV
TEKKEEEPVALNAFELISMSAGLNLGNLFDSEMEFKRETRFTSKCSPKEIVRKIEEAAKP
LGFDVRKKNYKLRLENVKAGRKGNLNVATEILRVGPSLHMVEVRKAKGDTLEFHKFYKNL
SNTLKDVVWKSDDLQKKPS
Download sequence
Identical sequences I1INS5
EG:BRADI4G26410.1 15368.BRADI4G26410.1 XP_003577877.1.954 XP_010237970.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]