SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010240224.2.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010240224.2.954
Domain Number 1 Region: 2164-2450
Classification Level Classification E-value
Superfamily BEACH domain 1.57e-125
Family BEACH domain 0.000000011
Further Details:      
 
Domain Number 2 Region: 2572-2641,2682-2797,2835-2882
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.02e-31
Family WD40-repeat 0.0076
Further Details:      
 
Domain Number 3 Region: 2038-2149
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-23
Family PreBEACH PH-like domain 0.0014
Further Details:      
 
Domain Number 4 Region: 293-332,375-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000158
Family SO2946-like 0.087
Further Details:      
 
Weak hits

Sequence:  XP_010240224.2.954
Domain Number - Region: 26-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0068
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010240224.2.954
Sequence length 2908
Comment PREDICTED: BEACH domain-containing protein C2 isoform X1 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MASSQEMSTEEMASTQEMSTGTSLPPPSPPPPPPPPLISGEQGSVEQLAALPLTDELGAE
EGAPSSKMSTGTPKTPSDPLPSMRSRHRPPGVPADAPLEVVRAVDAAIMGSRGGGVDRLR
EMLYEEQGELPHSVVDVLLGTMGGVDGLDKVGDGTGTGAPPSIMSNSHAAVTAAELLPDL
PCGEEPSPRTRMAIGLHAALRACTRNRAMCSLSGLLAILLESAEKLFIGTGQSSSGSWDG
TPLLQSIQLLGGHSLSVKDLHSWLGLVKKSLGTSWATPLMLALEKAMGSEEARGPAVTFE
FDGESSGLLGPGDSRWPFSSGYGFATWIYIESFSDTLSTATAAAAIAAAAAATSGKSSAM
SAAAAASALAGEGTTHMPRLFSFLSSDNQGVEAYFHGQFLVVESGGGKGKKASLHFTYAF
KPQRWYFVGLEHTNKHGLLGKGDSELRLYVDGSLHESRAFDFPRISKPLAFCCIGTNPPP
TIAGLQRRRRQCPLFAEMGPVYIFREPIGPDRMCRLALRGGDILPSFGNGAGLPWKATND
HIKNMAEESFALNHEIGGCLHLLYHPSLLNGRFCPDASPSGSAGTHRRPAEVLGLVYVSS
RVRPAESLWALAYGGPMALLPLTVSSVQTDSLEPALGELPLSLGTASLSAPIFRIISLAI
QHPGNNEELCRTCAPELLSRVLHYLLQAISKLESGEEEAVTDEELVTAIVSLCQSQGNNH
ELKVQLFGTLLLDLKMWSSCNYGLQKKLLSSLADMVFTESGCMQDANALQMLLDGCRRCY
WAIRESDSIDNLPRTGMERSLGEVNALIDELLVVIELLLGAASSTAASDDVRCLIGFIVD
CPQPNQVARLLHLIYRLIVQPNISRANMFGQSFISSGGVEALLVLLQREAKAGNNPGATL
SECDVLNNGDSDAKATTGDKDHQDDEIQLAEQHESILHEEDTEQEATSTKGASFKMLGAN
IGRKISNSENQLLKNLGGIRFSITADNVRNNVYNVDKADGIVVGIIHILGALVASGHLKF
ASSASNQHLAGGGLPTVHDEGNTMSEDRVSLLLFALQKAFQAAPRRLMTANIYMALISAA
INVSSVDENLNLYDCGHRFEHIQLLLVLLRTLPYASRSFQARAIQDILFLACSHPENRTT
LTSIAEWPEWILEVLIYNHEKGSKRNVDGVSIGEIEDLVHNFLIIMLEHSMRQKDGWKDV
EATIHCADWLSMVGGSSTGDQRSRREESLPIFKRRLLSSLLDFCARELQVQTEVIAAAAA
GVAAEGLSPEEAKVQAENAAHLSVALAENAIVILMLVEDHLRSQGQHFCMSRVLNSFLSS
ASMASSAPSRSNSLSRTGSEHIDAGLSRRSSLSSDAGGLPLDVLTSMADANGQISAAVME
RLTAAAAAEPYESVKHAFVSYGSCIADLAESWKYRSRLWYGVGIPSKSDLFGGGGSDWES
WKYVLEKDSNGNWVELPLVKKSVEVLRALLLDDSGLGGGLGIGGGSGPGMGVMAALYQLL
DSDQPFLCMLRMTLVSMREDDNGEGDALLKNTSIKDVISEGTGHQAGNMMPFDGNSPSFT
RKPRPALLWSVLGPILNMPISESKRQRVLVASSILYSEVWHAIGRDRSPLRKQYIELILP
PFVAILRRWRPLLAGVHELTSYDGRNPLIADDRALAADALPLEAALSMISPGWAAAFASP
PVAMALAMMAAGASGTETITTPRNTLNRRDTSLPERKAAARLQTFSSFQKPIEIAPIKPG
STPKDKAGAKAAALAATRDLERTAKIGSGRGLSAVAMATSGQRRSASDVERAKRWNTSEA
MSAAWMECLQSADSKPVSGREFSALSYKYVAILVSGFALARNLQRVEMERQTQADMLNRH
RASTGVRAWRHLLHCLTEMGRLYGPFEGPLCAPDRIFWKLDFTESSSRMRRFMKRNYKGS
DHLGAAADYDDRKLLSAAAQSNESNPEGADSSLTDTIPSNASVIMVEAMSVDDRNEENEQ
IESDTTTGSVDQLPHSSSADQQSVKGSVDSRSSGISTNRNLVRSAVVAPGYVPSEADERI
IVELPSLMVRPLKVVRGTFQVTSKRINFIIDEHGSETHMDDHACTSGEYYQQDKDRSWLV
SSLHQIYSRRYLLRRSALELFMVDRSNFFFDFGDMEARKNAYRAIIQTKPPNLNDIFLAT
QRAEQILKRTQLMERWANWEISNFEYLMELNTLAGRSYNDITQYPVFPWIIADYQSKVLN
LDDPSTYRDLSKPIGALNPERLKKFQERYSTFEDPIIPKFHYGSHYSSAGTVLYYLFRVE
PFTTLSIQLQGGKFDHADRMFSDLSGTWDSVLEDMSDVKELVPEMFYLPEVFTNINSIDF
GTTQLGGKLDFVELPHWAESPVDFIHKHRKALESEHVSTHLHEWIDLIFGYKQRGKEAVM
ANNVFFYITYEGTVDIDKIADPVQRRAMQDQIAYFGQTPSQLLTVPHMKRKSLTDVLQLQ
TIFRNPSELKSYVLPNPDRCNVPASTMFVSNDSIVVVDVNVPAAHVALHHWQPNTPDGQG
TPFLFHHGRNAANSTSGAFMRIFKGSTTSGEDYEFPRAIAFAASAIRSSAIVAVTSDKDI
ITGGHVDGSVKLISPDGAKTIESASGHLAPVTCVALSPDSNYLVTGSRDTTVILWRVHQA
GSIHKKNQPEPPQATPTTPRSPLPISPSSMGNLLETRRRRIEGPMHVLRGHLGEVLSCSV
SPDLGLVVSSSKMSGVLLHSLRTGRLIKKIHVAEAHTVSLSSQGVILVWSESKKRLSSFT
VNGLPIATSVLSPFSGRVSCIEISMDGHFALIGTCSSSNYKCEDSTENPDHELNKPSGND
ISEQTETAQSVHVPSICFVDLHKLKVLHTLKLEKGQDITAIALNKENTNLLVSTADKHLM
VFTDPALSLKVVDQMLRLGWEGDGLLQS
Download sequence
Identical sequences I1J0F6
XP_010240224.2.954 EG:BRADI5G17947.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]