SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010320710.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010320710.1.44838
Domain Number 1 Region: 1461-1729
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.73e-81
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00018
Further Details:      
 
Domain Number 2 Region: 437-609
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.44e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.00034
Further Details:      
 
Domain Number 3 Region: 392-443,602-629
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0000192
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.048
Further Details:      
 
Domain Number 4 Region: 36-110
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000317
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010320710.1.44838
Sequence length 1738
Comment PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MGVPDSSLLDLIEKVKAWIKWGKSDRTSLVGGSDMDVESCKTCYECKMKFTDSCLKFHCL
SCSRVFCRDCVVHIFGSSDVFSSGSGESKNTVRSVVDIKVCKFCSDLSNCHRSTRKFCDK
VYPSESPRESPEPPSPNFSSDMFDGYSTHDASKSSFTAFSSHPSPVSLRHSPSRSDEDEG
GDFTNQSVSPSSDCCHDTSDLESCSVSARHKFYHLRSFGSSPSNSPSRIRFTSNRVGHSV
QDQQETPRSQNDGPFDQETLVVLGRLEKDNEDPETANDSNNLSVYRDQLEKQQKPLDFEN
NGPIWFPPPPDDEDDEAQNNFFTYDDEDDEIGETGTTFSSSGSLSSIFPAKDKQQLDHKE
PLRSVVHGHFRALVLQLLQGEDIHSGKESAADDWIDIVTSLAWQAANYVKPDTSKGGSMD
PVDYVKIKCIASGTRSDSTLIKGVVCTKNIKHKRMTSQYKNARLLILGGALEYQRAATQL
ASFDTLLQQEKEHLKMIVSRIEAHHPNVLLVEKSVSSYAQELLLEKEISLVLNVKVPLLE
RVARCTGALITPSIDNIATTRLGHCELFHLEKVSEEHEHANQLNKRTSKTLMFFDGCPRR
LGCTVLLRGSCREELKKLKKVVQYAVFAAYHLSLETSFLADEGASLPKESAATSIAIPER
TSADNAISVISHSAVPVRAQRVANDPNVQIGSNFTVEAVLPESLSEHHYPQYGDQSNLDD
GGARDVLITADHANLSLFSAHDTKPVGSIEIEDQTIERSVETSGQEESQPIELGDLSKLE
RSDETKIPDEFYSAADSRQSILVSFSSRCVLNGTVCVRSRLLRIKFYGSFDKPLGRYLQD
DLFGQISSCQSCKEPAEAHVICYTHQQANLTINVRRLPLVNSLPGERDKKIWMWHRCLKC
AQIEGVPPATRRVIMSDAAWGLSFGKFLELSFSNHATANRVASCGHSLQRDCLRYYGCGS
MVAFFRYTPIDILSVRLPPLTLEFSGYTEQEWLRKEAAELLCKAKALYAEISSAFRRVEE
KSYPVECEPSDTTQLHDCIVELKELLMKEKNDYHDFLQLDEDETFDPRQGAIDILELNRL
RHSLVIASHVWDRRLLSMKSFLQKSSGSVGSEDCGSCNELIDWRRDMFLKNDTLEHVYEE
SVPEFSDSEEYPEKALQSEQEGTGVSPYGSGELESSMLTSSESETMQEMQTEGENTFNQT
SLERAPSAASVLSDQIDFAWSGTDCSPKKAQLLQGDRSEAAPLRQPSQLDLPPFRRLKLP
ARVHSFDSAMRLQDRIRKGLPPSSLHLSSIRSFHASGDYKNMIRDPVSSVQRTYSQMSPS
EAHKFNLLMGSSPSFISYASLIPDGSRLMVPLNGSIDVVLAVYDNEPTSIISYALCSKVY
SDWVTDKSSVSERSWNTSDTNKEAGVAFSLSTWQSFGSLDTDYMHYGSHGSEDASSTITS
LFSDSKTSPHLRISFDDESSSSGGKVKFSVTCYFAKQFDALRRKCCPDELDFVRSLSRCK
RWSAQGGKSNVYFAKSFDERFIIKQVQKTELDSFEEFAPEYFKYLTNSINSRSPTCLAKV
LGIFQVSVKHLKGGRETKMDLIVMENIFFERKISRVYDLKGSLRSRYNADTTGANKVLLD
MNLLETLHTKPIFLGSKAKRSLERAVWNDTSFLASVDVMDYSLLVGVDEERKELVLGIID
FMRQYTWDKHLETWVKASGILGGPRNASPTIVSPKQYKKRFRKAMTTYFLTVPDQWSS
Download sequence
Identical sequences K4BWZ4
Solyc05g008200.2.1 Solyc05g008200.2.1 XP_010320710.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]