SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010403140.1.2935 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010403140.1.2935
Domain Number 1 Region: 500-755
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 199-429
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-50
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 802-1061
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-39
Family YWTD domain 0.000061
Further Details:      
 
Domain Number 4 Region: 19-148
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-29
Family YWTD domain 0.0000961
Further Details:      
 
Domain Number 5 Region: 1192-1227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1154-1190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1113-1153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 758-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000339
Family EGF-type module 0.039
Further Details:      
 
Domain Number 9 Region: 455-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000385
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 153-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1070-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000612
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010403140.1.2935
Sequence length 1472
Comment low-density lipoprotein receptor-related protein 5 isoform X1 [Corvus cornix cornix]; AA=GCF_000738735.2; RF=representative genome; TAX=932674; STAX=181096; NAME=Corvus cornix cornix; AL=Scaffold; RT=Major
Sequence
MLLRLTSSIHKASFSGQIYMYWTDWGETPRIERAGMDSSMRKIIVDSDIYWPNGLTIDLD
EQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNK
RTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPT
GVQLEDDGRTCKAGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEG
YIYWTDDDVRAIRRAYLDGAGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRL
NGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWP
NGLALDLEKNKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQR
RSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAENNGGCSHLCFFTPQEARC
ACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVS
DNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVA
RLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGR
ANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNL
HSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFR
CGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYD
PLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCE
ATNSVNVHRLNGESIGMVLRGDHDRPRAIVVNAERGYMYFTNMQERAPKIERAALDGTER
EVLFTTGLIRPVALVVDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPTGLTVL
GNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSRDNGG
CSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGF
PECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEADCDTICLPNQFRC
ASGQCIPLKQQCDSFPDCIDGSDELMCEKSKPASDESQPHSSAIGPVIGIILSLFVMGGM
YFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSL
MGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPS
NTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQY
MSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_010403140.1.2935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]