SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010408525.2.2935 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010408525.2.2935
Domain Number 1 Region: 630-885
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 19-278
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 328-564
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-50
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 4 Region: 933-1192
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-40
Family YWTD domain 0.00004
Further Details:      
 
Domain Number 5 Region: 887-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000745
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1309-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 585-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 1271-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 281-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000269
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 10 Region: 1236-1270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 1202-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000218
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010408525.2.2935
Sequence length 1596
Comment low-density lipoprotein receptor-related protein 6 isoform X2 [Corvus cornix cornix]; AA=GCF_000738735.2; RF=representative genome; TAX=932674; STAX=181096; NAME=Corvus cornix cornix; AL=Scaffold; RT=Major
Sequence
MLTHLSVCPPISVPCAAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVFLK
GLIYWSDVSEEAIKRTEFNKSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVS
NLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIY
WPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDW
NTHSILACSKYSGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPT
KPSYQCACPTGVKLLENGKTCKDGATALLLLARRTDLRRISLDTPDFTDIVLPLEDIRHA
IAIDFDPLEGYIYWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDT
GTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRI
VLVNTSLGWPNGLALDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLE
DYIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCAEDNGGCSHL
CLYRPQGLRCACPIGLELISDMRTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK
EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWA
DTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSE
RTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQ
DYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSH
LCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIH
SLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSID
IYSRYIYWTCEATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPK
IERAALDGTEREVLFFSGLSKPIALAIDSHLGKLFWADSDLRRIESSDLSGANRIVLEDS
NILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEY
RQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGGEIDCIPVAWRCDGFTEC
EDHSDEKNCPVCSDSQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASG
QCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQR
VLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSS
GPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYS
YRPYSYRHFAPPTTPCSTDVCDSDYAPSRRLPAAAAKGYTSDLNYDSEPVPPPPTPRSQY
LSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_010408525.2.2935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]