SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010560836.1.12557 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010560836.1.12557
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-49
Family YWTD domain 0.00000231
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-39
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-28
Family YWTD domain 0.0000979
Further Details:      
 
Domain Number 5 Region: 1173-1210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1135-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1094-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 739-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000331
Family EGF-type module 0.039
Further Details:      
 
Domain Number 9 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000408
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1051-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000716
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010560836.1.12557
Sequence length 1453
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Haliaeetus leucocephalus]; AA=GCF_000737465.1; RF=representative genome; TAX=52644; STAX=52644; NAME=Haliaeetus leucocephalus; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDI
QVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEVL
LLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDG
SGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAI
VLNPVMGYMYWTDWGESPKIECAYLDGSERRILVNTSLGWPNGLALDLEKDKLYWGDAKT
DKIEVINIDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIKASRDIIIDQ
LPDLMGLKATSVTKVFGTNSCAENNGGCSHLCFFTPQETRCACPIGLELLSDMKTCIIPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPR
SLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLD
TSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSP
ASFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRA
KDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVL
RGDHDKPRAIVVNAERGYMYFTNMQDRAPKIERAALDGTEREVLFTTGLIRPVALVIDNK
LGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEK
MNGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSRDNGGCSHICIAKGDGTPRCSCPE
HLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQ
FQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDTICLPNQFRCASGQCILLKQQCDSFPDCI
DGSDELMCEKTKPASDESQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPF
PHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGAS
SSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRPYLIRGIAPPTTP
CSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFH
LYPPPPSPCTDSS
Download sequence
Identical sequences XP_010560836.1.12557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]