SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010595758.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010595758.1.64505
Domain Number 1 Region: 11-149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-29
Family G proteins 0.0000961
Further Details:      
 
Domain Number 2 Region: 149-188
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000615
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010595758.1.64505
Sequence length 241
Comment PREDICTED: ras-related protein Rab-40C isoform X2 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MGTQGSPVKSFDYLLKFLLVGDSDVGKGEILESLQDGASESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEVSPLCN
FNVTESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKS
HLKSFSMANGMNAVMMHGRSYSLAGGGGGGGSKGNSLKRSRCIRPPQSPPQNCSRSNCKI
S
Download sequence
Identical sequences XP_010595758.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]