SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010611260.1.5607 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010611260.1.5607
Domain Number 1 Region: 78-185
Classification Level Classification E-value
Superfamily FKBP-like 1.96e-36
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 2 Region: 188-289
Classification Level Classification E-value
Superfamily FKBP-like 1.16e-29
Family FKBP immunophilin/proline isomerase 0.00056
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily FKBP-like 1.02e-22
Family FKBP immunophilin/proline isomerase 0.0015
Further Details:      
 
Domain Number 4 Region: 296-370
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000662
Family Calmodulin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010611260.1.5607
Sequence length 381
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9 [Fukomys damarensis]; AA=GCF_000743615.1; RF=representative genome; TAX=885580; STAX=885580; NAME=Fukomys damarensis; AL=Scaffold; RT=Major
Sequence
MKTYDTYVGIGWLIPGMDTGLLGMCVGERRIITIPPFLAYGEAGDGKDIPGQASVVFDVM
LLDLHNPKDSISVENQVVPESCERRSQSGDFLRYHYNGTLLDGSLFDSSYSRNRTFDTYI
GQGYVIPGVDQGLLGVCVGERRRIVVPPHLGYGEEGRGNIPGSAVLVFDVQVVDFHNPSD
PVSITSRYRPPDCSELSKKGDFLKYRYNASLLDGTLLDSTWNLGKTDSAVLGFGQVVLGV
DMGLRDMCVGERRTVVVPPHLGYGEAGVAGEVPGSAVLVFDIELLELVAGLPEGYMFVWT
GEVSPHLFEEIDRDGDGGVLLEEFAEYIHAQVGSGRGKLAPGFDAQMIVRNMFANQDRDG
DGKVTAQEFKLKGQEAKHDEL
Download sequence
Identical sequences A0A091CLU8
XP_010611259.1.5607 XP_010611260.1.5607 XP_010611261.1.5607 XP_010611262.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]