SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010654131.1.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010654131.1.54126
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000855
Family Canonical RBD 0.0035
Further Details:      
 
Weak hits

Sequence:  XP_010654131.1.54126
Domain Number - Region: 234-258
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000112
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010654131.1.54126
Sequence length 685
Comment PREDICTED: serine/arginine-rich splicing factor 4-like [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MSLYLGNLSSHIRRDDLERVFWRFGRCNIQLKDGYGFAVYDFPANADKAMRAMRGKNICG
ERISLTWSNKQPRGFQRGARSYELQRGRISNRKLGSKSQRGYKVGVKKLDRDGYRSDAVE
MLDEERSYNQDNIKDYGEENHHNAGENLSYEGGSIEPDAVDNDRWGQHVGNLSNGNGLEN
GMEFDRYEPYHGEDRSNEDDNIQMTYSGGSPTLRSTQEKTGREQIGDAILLPSNIPKPQL
ACYHCGRPGHKMRNCLQGNASQKKFSRFDLKRNDEINLRGSGGGELPRTGSKPHEKGHSG
SRDTISLRWHTNDRKASGSGKYRRLIRSGSSAARKESHRTQGKEYGGKKQSRMETGTPKR
HIKKARTSVSPPMPSDYTTSRSCSHSKSLKSIPGCSSPSRSRSVSSKHFLSSIPKSSSTS
RNSRSGCAKSRRSSSPTSLSLSVSLGKPLLSSPNKVERKLNGSSVDVTNPESKEVLAGQG
QQVEGDAGSENSKQENTMAAVENENAVSFIKMEDDMNKNQPQQRDDHGNCIPLTSNELKN
PCTEKGAFTPTILSPESLRETAELQNSGAWMMEHLLAPTKKPDSEAMAGSFAGNSTCISS
EEVFKILKYYGLEHSEDNKMHLPVEDYFGSARLWPWEIIYYRRLKKGPISTENYDRRIAQ
NREFGIVDKYIRSSSGWGELVQDNV
Download sequence
Identical sequences 29760.GSVIVG00021533001 XP_010654131.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]