SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010714406.2.16129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010714406.2.16129
Domain Number 1 Region: 628-883
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 17-276
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 327-562
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-49
Family YWTD domain 0.00000361
Further Details:      
 
Domain Number 4 Region: 931-1190
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-40
Family YWTD domain 0.0000386
Further Details:      
 
Domain Number 5 Region: 885-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000237
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1321-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 1242-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 583-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000228
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1283-1319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 279-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1200-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000693
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010714406.2.16129
Sequence length 1608
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Meleagris gallopavo]; AA=GCF_000146605.2; RF=representative genome; TAX=9103; STAX=9103; NAME=Meleagris gallopavo; breed=Aviagen turkey brand Nicholas breeding stock; AL=Chromosome; RT=Major
Sequence
MSVCPPHPLFLPLQAAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVDFVFIKGL
IYWSDVSEEAIKRTEFNKSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNL
DGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWP
NGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNT
HSILACSKYSGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKP
SYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIA
IDFDPLEGYIYWTDDEVRAIRRSFVDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVL
VNTSLGWPNGLALDYEESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDY
VYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCL
YRPQGLRCACPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEA
SALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADT
GTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRASMDGSERT
TLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDY
IYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLC
LAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSL
RNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIY
SRYIYWTCEATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIE
RAALDGTEREILFFRGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRVVLEDSNI
LQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNVQEYRQ
HPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCI
PVAWRCDGFTECEDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQDNSDEKNCEV
LCLTNQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTL
FVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKS
MISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGY
SSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTATMAKGYTSDLNYDSE
PVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_010714406.2.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]