SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010808566.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010808566.1.76553
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily FKBP-like 1.12e-19
Family FKBP immunophilin/proline isomerase 0.000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010808566.1.76553
Sequence length 80
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP1B isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQLGPLSPLPICPHPC
Download sequence
Identical sequences A0A250Y8M0 A0A2J8NLE4 A0A2K5DN32 F7IR03 Q5R7Y7
ENSP00000370379 NP_001126241.1.23681 NP_473374.1.87134 NP_473374.1.92137 XP_003432199.1.84170 XP_003949814.1.37143 XP_004091398.1.23891 XP_004268131.1.21590 XP_004312232.1.83887 XP_004377619.1.4749 XP_004394987.1.74151 XP_004418345.1.5094 XP_004627513.1.9945 XP_004745957.1.14098 XP_005895727.1.15283 XP_006050700.1.26621 XP_006744329.1.47382 XP_006767595.1.95426 XP_007114826.1.24612 XP_007455558.1.90284 XP_008160598.1.99482 XP_008587335.1.73410 XP_008847033.1.79516 XP_008950626.1.60992 XP_008979322.1.60252 XP_010344072.1.74449 XP_010590254.1.64505 XP_010808566.1.76553 XP_011354877.1.92234 XP_011995309.1.54773 XP_012308758.1.9421 XP_013851759.1.46622 XP_014710158.1.49734 XP_015443738.1.64745 XP_015977256.1.101085 XP_017382254.1.71028 XP_017911072.1.57651 XP_019306285.1.44245 XP_020015306.1.5219 XP_020726144.1.74333 XP_021553414.1.83697 ENSCJAP00000014283 ENSP00000370379 gi|17149839|ref|NP_473374.1| 9600.ENSPPYP00000014074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]