SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010809806.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010809806.1.76553
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000502
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 2 Region: 98-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000157
Family VWC domain 0.043
Further Details:      
 
Domain Number 3 Region: 193-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010809806.1.76553
Sequence length 250
Comment PREDICTED: WNT1-inducible-signaling pathway protein 2 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MRGTFQTHLLAFSLLCLLSKVCAQLCPTPCACPWPPPRCPPGVPLVLDGCNCCRVCARRL
GEPCDHLHVCDPSQGLVCQPGAGPGGRGAVCLWGEDDGSCEVNGRLYRDGETFQPHCRLR
CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVPGKCCPEWVCDQGVGLGVQPLPAQGSQ
FSGLVAPPAPGVPCPEWSTAWGPCSTTCGLGVATRVSNQNRFCRLETQQRLCVLGPCPPA
RGHSPRSRAF
Download sequence
Identical sequences F1N0A1
9913.ENSBTAP00000007931 XP_005214836.1.76553 XP_010809806.1.76553 ENSBTAP00000007931 ENSBTAP00000007931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]