SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010839227.1.44457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010839227.1.44457
Domain Number 1 Region: 398-612
Classification Level Classification E-value
Superfamily L domain-like 1.93e-36
Family Ngr ectodomain-like 0.0067
Further Details:      
 
Domain Number 2 Region: 48-281
Classification Level Classification E-value
Superfamily L domain-like 3.88e-33
Family Ngr ectodomain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010839227.1.44457
Sequence length 980
Comment PREDICTED: SLIT and NTRK-like protein 3 [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence
MMKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHI
HCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGNNALQDIQTG
AFNGLKILKRLYLHENKLDIFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLI
LNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRSLMELQLEENPWNCTCE
IVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHLS
SNKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYPGPNQPP
IAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNL
IQKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGL
QSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYF
LYLPVAGVLEHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTH
RDVRTIELEVLCPEMLHIAPAGASPAQPGDAHLAGGPTSASPYEFSPPGGPVPLSVLILS
LLVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGN
GGGGRPTISSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVVVSSGPEAGGAERGA
PVTQPPGMGEVLLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTMNHHHPH
PHHSAVGGVSGVVAGTGGDLVGFRHHEKNGGVVLFPPGGGCGGSSMLLDRERPQPAPCTV
GFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELR
AKLQTKPDYLEVLEKTTYRF
Download sequence
Identical sequences F1N513
ENSBTAP00000052577 ENSBTAP00000052577 XP_003585735.1.76553 XP_003585736.1.76553 XP_005895397.1.15283 XP_005895398.1.15283 XP_010822681.2.59421 XP_010839227.1.44457 XP_015317574.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]