SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011230136.2.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011230136.2.58354
Domain Number 1 Region: 503-758
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 202-441
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 806-1065
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 20-151
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-28
Family YWTD domain 0.0000367
Further Details:      
 
Domain Number 5 Region: 760-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1196-1234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 458-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1117-1157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1158-1194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 154-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000658
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1075-1128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000291
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011230136.2.58354
Sequence length 1484
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MPVSRKSVIRYLIFSSHDFTEFMYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTL
DYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILA
CNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCA
CPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDP
VEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEV
TRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSL
GWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTD
WQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQG
LRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDF
DVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRI
EVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPN
VGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTD
WSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPV
GGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRA
IDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIY
WTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALD
GTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVG
LTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQ
DNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWR
CDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLID
QFRCSNGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGT
IYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSL
SIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSP
STHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPP
PPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_011230136.2.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]